[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68321.1
DDBJ      :             putative beta-hydroxylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  78/915 : Eukaryota  77/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:250 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   98->227 1e5rA PDBj 1e-08 17.5 %
:RPS:SCOP  150->223 1e5rA  b.82.2.4 * 1e-09 20.8 %
:HMM:SCOP  102->223 1e5sA_ b.82.2.4 * 5.6e-14 26.7 %
:RPS:PFM   104->226 PF05118 * Asp_Arg_Hydrox 4e-23 43.0 %
:HMM:PFM   70->227 PF05118 * Asp_Arg_Hydrox 1.1e-57 42.7 157/163  
:BLT:SWISS 48->239 ASPH_MOUSE 5e-26 34.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68321.1 GT:GENE BAC68321.1 GT:PRODUCT putative beta-hydroxylase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(765101..765853) GB:FROM 765101 GB:TO 765853 GB:DIRECTION - GB:PRODUCT putative beta-hydroxylase GB:NOTE PF05118: Aspartyl/Asparaginyl beta-hydroxylase GB:PROTEIN_ID BAC68321.1 LENGTH 250 SQ:AASEQ MTPEIENAFAAIRAEFGAESIRRVEQMLEPSGSERHPLQKAAKWIMPGLSPTPWHDPYAYAELAPVVHELEASHQAIKEELKVAWSARREAFSDYEHYLTRQDNWQALYLFREGGITEESAATVPIAYQVLKDVAVDTGKICPLLECHFSTLLPGAVIEPHCDLWNFSINLHLAVDIPDGCSITVAGETRSWEEGKCLLFDYSFEHEARNTGTRPRTCLLIDLWHPETTVPERRALVALITEIRRLMGED GT:EXON 1|1-250:0| BL:SWS:NREP 1 BL:SWS:REP 48->239|ASPH_MOUSE|5e-26|34.8|187/741| RP:PDB:NREP 1 RP:PDB:REP 98->227|1e5rA|1e-08|17.5|120/260| RP:PFM:NREP 1 RP:PFM:REP 104->226|PF05118|4e-23|43.0|121/150|Asp_Arg_Hydrox| HM:PFM:NREP 1 HM:PFM:REP 70->227|PF05118|1.1e-57|42.7|157/163|Asp_Arg_Hydrox| GO:PFM:NREP 4 GO:PFM GO:0004597|"GO:peptide-aspartate beta-dioxygenase activity"|PF05118|IPR007803| GO:PFM GO:0018193|"GO:peptidyl-amino acid modification"|PF05118|IPR007803| GO:PFM GO:0030176|"GO:integral to endoplasmic reticulum membrane"|PF05118|IPR007803| GO:PFM GO:0055114|"GO:oxidation reduction"|PF05118|IPR007803| RP:SCP:NREP 1 RP:SCP:REP 150->223|1e5rA|1e-09|20.8|72/260|b.82.2.4| HM:SCP:REP 102->223|1e5sA_|5.6e-14|26.7|116/0|b.82.2.4|1/1|Clavaminate synthase-like| OP:NHOMO 304 OP:NHOMOORG 155 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------2--1------------------------------------------------------------------------------3-1-----------------4---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------1---1---------1---1--1-----------1-----------11111111-----1--------------------------------1-12--11111111121----------------2------111-1-------1-11-----1------------------------------------------1---------------------------------1----1-----------------------------------------------------------------------------1---1---1-----1----------------------------------1111------------------------------3-----1-11-1111----------------------------11111111111111----------------------------------------------------------- ------1-----------------------------------------------------------------------------------------------------B133222322232231852326E3-34433-22333213321322622222324-2111111-13221---C-111---1----4112227 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 53.2 SQ:SECSTR #################################################################################################ccccccEEEEEEEEccccTTTTcccHHHHHHHHHcc########cccEEEEEEEEEEcEEEEEEcccccccEEEEccccTTTTEEEEETTEEEcccTTEEEEccTTccEEEEEcccccccEEEEEEccccccTcccTTTcc############ DISOP:02AL 1-2, 248-250| PSIPRED cccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccEEEEEEEEEEcccccEEEEccEEEEEEcccEEEEEcccEEEEEEcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccc //