[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68325.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:PROS 157->171|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68325.1 GT:GENE BAC68325.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(768752..769429) GB:FROM 768752 GB:TO 769429 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF04207: Tetrahydromethanopterin S-methyltransferase, subunit D GB:PROTEIN_ID BAC68325.1 LENGTH 225 SQ:AASEQ MTAGWCARAIRAAVFAAVCVLLAALGHVLMSGSTVPWWTMTAGFAATTGVGWCLAGRERGLALVVPAAVVAQGALHSAFSLAQSAASDTGAGGVAHGMRGMSMSATSMDAMDMRSAPMGCSEQPGQLGHLVHDMGGGSSFGMLAAHALAAVLSGLWLAYGERAAFRVLRAVAGWLAAPLRLSLALPAPPCRPRLVPTRERSERVPRLSLAHTIISRGPPAGMAVA GT:EXON 1|1-225:0| PROS 157->171|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 4 TM:REGION 10->32| TM:REGION 61->83| TM:REGION 137->159| TM:REGION 166->188| SEG 6->29|carairaavfaavcvllaalghvl| SEG 61->71|lalvvpaavva| SEG 101->116|msmsatsmdamdmrsa| SEG 175->196|laaplrlslalpappcrprlvp| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 85-121, 192-205, 220-225| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHEEEcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHccccccccccccHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEccccccccccc //