[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68326.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.2.10
:173 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  50->168 1x9lA  b.2.10.1 * 1e-07 19.0 %
:HMM:SCOP  23->172 1x9lA_ b.2.10.1 * 1.1e-19 27.9 %
:HMM:PFM   53->160 PF04314 * DUF461 1.3e-17 27.4 106/110  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68326.1 GT:GENE BAC68326.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(769580..770101) GB:FROM 769580 GB:TO 770101 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF04314: Protein of unknown function (DUF461) GB:PROTEIN_ID BAC68326.1 LENGTH 173 SQ:AASEQ MTGQQVWRPTRRRLTDTLIATLSPVAVCGLALGGLSTWTAYGNAGSPARIAVTGGRVYLPYGNAQDTAAFFRITNSGGSADRLLKVTSRAVDGAGTFSRHRMTGARSASAQTVASVAVPAGGSLAMSPHGLDVTVPANAGWQAGDLVSFTLRFARSGAVKTLAVVVRPGQDGT GT:EXON 1|1-173:0| TM:NTM 1 TM:REGION 15->37| SEG 105->120|arsasaqtvasvavpa| HM:PFM:NREP 1 HM:PFM:REP 53->160|PF04314|1.3e-17|27.4|106/110|DUF461| RP:SCP:NREP 1 RP:SCP:REP 50->168|1x9lA|1e-07|19.0|116/149|b.2.10.1| HM:SCP:REP 23->172|1x9lA_|1.1e-19|27.9|147/0|b.2.10.1|1/1|DR1885-like metal-binding protein| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 170-173| PSIPRED cccccEEEcccccHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccEEEccEEEEccccccccEEEEEEEEcccccEEEEEEEccccccEEEEEEEEEccccEEEEEEcccEEcccccEEEEcccccEEEEEcccccccccEEEEEEEEccccEEEEEEEEEccccccc //