[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68328.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->27 PF03369 * Herpes_UL3 0.0008 45.5 22/135  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68328.1 GT:GENE BAC68328.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(772353..772664) GB:FROM 772353 GB:TO 772664 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF07172: Glycine rich protein family GB:PROTEIN_ID BAC68328.1 LENGTH 103 SQ:AASEQ MAGPTTELVRRDPTDAVRRDLETRLMEESRQSSLTGAGTALRRAAPPPALCGFLLLLALIFTVSYAVGAGAGPVAPGMHGGGTNRDGGGGGMDDMGNMQGGHG GT:EXON 1|1-103:0| TM:NTM 1 TM:REGION 49->71| SEG 34->59|ltgagtalrraapppalcgfllllal| SEG 66->102|avgagagpvapgmhgggtnrdgggggmddmgnmqggh| HM:PFM:NREP 1 HM:PFM:REP 6->27|PF03369|0.0008|45.5|22/135|Herpes_UL3| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 26-37, 82-90, 95-103| PSIPRED ccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccc //