[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68331.1
DDBJ      :             putative MarR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   85->150 1qvrA PDBj 8e-04 25.8 %
:RPS:PDB   55->152 2a61A PDBj 3e-07 25.5 %
:RPS:SCOP  55->152 2a61A1  a.4.5.28 * 1e-09 25.5 %
:HMM:SCOP  55->154 1jgsA_ a.4.5.28 * 5.2e-11 28.1 %
:HMM:PFM   56->91 PF09339 * HTH_IclR 3.5e-06 38.9 36/52  
:HMM:PFM   83->119 PF08913 * VBS 0.0002 35.1 37/125  
:BLT:SWISS 57->104 YCGE_BACSU 2e-05 48.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68331.1 GT:GENE BAC68331.1 GT:PRODUCT putative MarR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 774469..774984 GB:FROM 774469 GB:TO 774984 GB:DIRECTION + GB:PRODUCT putative MarR-family transcriptional regulator GB:NOTE PF01047: MarR family GB:PROTEIN_ID BAC68331.1 LENGTH 171 SQ:AASEQ MNLVRCMLGGVNGVELFLLGRVLMKIGEEALPEPPGGAGRYAGSARLVLIVASDIAAHPDTAVGEIAARTGLPQSQVSAAVARLKEARSVQTAPDPADRRRVLVRQAAEVSERVAQVRAVGIEDALARALGSDAPHRLREVSEALDVLARNLLPQSGAPESPQADIVPPSR GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 57->104|YCGE_BACSU|2e-05|48.9|47/100| BL:PDB:NREP 1 BL:PDB:REP 85->150|1qvrA|8e-04|25.8|66/803| RP:PDB:NREP 1 RP:PDB:REP 55->152|2a61A|3e-07|25.5|94/142| HM:PFM:NREP 2 HM:PFM:REP 56->91|PF09339|3.5e-06|38.9|36/52|HTH_IclR| HM:PFM:REP 83->119|PF08913|0.0002|35.1|37/125|VBS| RP:SCP:NREP 1 RP:SCP:REP 55->152|2a61A1|1e-09|25.5|94/139|a.4.5.28| HM:SCP:REP 55->154|1jgsA_|5.2e-11|28.1|96/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 69.0 SQ:SECSTR ################################################HHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHEcccTTcccTTcEE##### DISOP:02AL 154-167, 169-171| PSIPRED ccHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccc //