[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68333.1
DDBJ      :             putative LuxR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.6
:98 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->86 1zlkA PDBj 3e-06 34.0 %
:RPS:PDB   28->87 3cloA PDBj 4e-13 30.0 %
:RPS:SCOP  35->87 1fseA  a.4.6.2 * 7e-12 34.0 %
:HMM:SCOP  15->91 1p4wA_ a.4.6.2 * 2.4e-13 31.2 %
:RPS:PFM   37->89 PF00196 * GerE 5e-06 43.4 %
:HMM:PFM   36->87 PF00196 * GerE 2.4e-19 36.5 52/58  
:BLT:SWISS 27->87 Y914_MYCBO 4e-11 50.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68333.1 GT:GENE BAC68333.1 GT:PRODUCT putative LuxR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 776002..776298 GB:FROM 776002 GB:TO 776298 GB:DIRECTION + GB:PRODUCT putative LuxR-family transcriptional regulator GB:NOTE PF00196: Bacterial regulatory proteins, luxR family GB:PROTEIN_ID BAC68333.1 LENGTH 98 SQ:AASEQ MLETMGMTAFAERAGRELRAAGGTAHKRTAPARHEELTAQESQIARMARDGLSNPEIGTRLFISARTVQYHLRKVFTKLGITSRSQLDRVLPSGPGGA GT:EXON 1|1-98:0| BL:SWS:NREP 1 BL:SWS:REP 27->87|Y914_MYCBO|4e-11|50.8|61/882| SEG 9->25|afaeragrelraaggta| BL:PDB:NREP 1 BL:PDB:REP 37->86|1zlkA|3e-06|34.0|50/65| RP:PDB:NREP 1 RP:PDB:REP 28->87|3cloA|4e-13|30.0|60/249| RP:PFM:NREP 1 RP:PFM:REP 37->89|PF00196|5e-06|43.4|53/57|GerE| HM:PFM:NREP 1 HM:PFM:REP 36->87|PF00196|2.4e-19|36.5|52/58|GerE| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 1 RP:SCP:REP 35->87|1fseA|7e-12|34.0|53/67|a.4.6.2| HM:SCP:REP 15->91|1p4wA_|2.4e-13|31.2|77/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 85 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- ----7---111---11122-21--2622222-42221-24--1141------1-1---------2223821---------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 67.3 SQ:SECSTR #########################HHccHHHHTTcccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHcHHH####### DISOP:02AL 6-7, 17-38, 96-98| PSIPRED cHHHcccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHcccccc //