[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68336.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->242 1nkvC PDBj 4e-15 31.4 %
:RPS:PDB   49->204 3e05B PDBj 3e-11 12.8 %
:RPS:SCOP  49->170 1im8A  c.66.1.14 * 8e-14 21.2 %
:HMM:SCOP  11->264 1nkvA_ c.66.1.21 * 3.6e-31 26.4 %
:RPS:PFM   52->253 PF02353 * CMAS 4e-08 30.5 %
:HMM:PFM   53->154 PF08242 * Methyltransf_12 1.2e-12 27.1 96/99  
:BLT:SWISS 29->242 YJHP_ECOLI 2e-19 28.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68336.1 GT:GENE BAC68336.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 778334..779140 GB:FROM 778334 GB:TO 779140 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF08242: Methyltransferase domain GB:PROTEIN_ID BAC68336.1 LENGTH 268 SQ:AASEQ MSVAGMPGLALRPMDDKDLPPRLTHLTFHGPLSEARAARIIGRLARAAPSTVLDIGCGWGELMLRTLETVEGATGLGIDLNGQDIARGRENAKARALADRVKFVEESAAGTARGPADLVLCLGASHTLSDAQPPQHTTAALHALRRLVQPGGRVLLGENFWQRTPTSAELDAMWPGARAEEFHDLAGLVDLAVASGFRPAWIETASSDEWDEFESGYQSDVEEWLAAHSDHPLAAETRERVDRHRASWLKGYRGVLGLAYLTLVPVDH GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 29->242|YJHP_ECOLI|2e-19|28.0|207/248| SEG 35->48|araariigrlaraa| BL:PDB:NREP 1 BL:PDB:REP 52->242|1nkvC|4e-15|31.4|175/242| RP:PDB:NREP 1 RP:PDB:REP 49->204|3e05B|3e-11|12.8|148/192| RP:PFM:NREP 1 RP:PFM:REP 52->253|PF02353|4e-08|30.5|164/271|CMAS| HM:PFM:NREP 1 HM:PFM:REP 53->154|PF08242|1.2e-12|27.1|96/99|Methyltransf_12| GO:PFM:NREP 1 GO:PFM GO:0008610|"GO:lipid biosynthetic process"|PF02353|IPR003333| RP:SCP:NREP 1 RP:SCP:REP 49->170|1im8A|8e-14|21.2|118/226|c.66.1.14| HM:SCP:REP 11->264|1nkvA_|3.6e-31|26.4|242/245|c.66.1.21|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 76 OP:NHOMOORG 69 OP:PATTERN --------------------------------------------111--------------------- ----1---------------------------1------------1---11--11---------1-1122--------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------11---------------------------------------------------------------------------------1-----1----------------12---------1---1--1--1111111-1--11-----------------------------1-----------------------------------------------1---1--------11-------11111111121----11-11111111121211-----------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 80.2 SQ:SECSTR ################################################TcEEEEETcTTcHHHHHHHHHcTTcEEEEEEccHHHHHHHHHHccHHHHTcTTEEEEEccTTTTcTTcccccEEEEcccTTcHHHHHHHHHHHHHHHHHccTTcEEEEEEccHHHHHHHHHHHHHTTcEEEEEEEccEEccccccccccEEcccEEEEEEEETEEEETEEEEEEEEEEcHHHHHHHHTETEEEEEEcTTTTcccccEEEEEEEEE##### DISOP:02AL 1-5| PSIPRED cccccccccccccccccccccHHHcccccccccHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEcccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHccccHHHcccHHHHHHHHHHcccEEEEEEEEccccHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcHHHEEHHEEEccccc //