[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68339.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   80->116 PF04674 * Phi_1 0.00051 22.2 36/273  
:HMM:PFM   44->71 PF06495 * Transformer 0.00072 32.1 28/182  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68339.1 GT:GENE BAC68339.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 782844..783239 GB:FROM 782844 GB:TO 783239 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68339.1 LENGTH 131 SQ:AASEQ MTTLPTTSAAAAERLGPARALTRAVAAYSALWRPFGTNDGSGLVREQVPVAADDKPYSYEWPYSQVHIAALDLTAVDAAYESEPAERTKAQEHFWHVGKGTTGCPGYASYPVVACGEGGEGGAAPRRRPAP GT:EXON 1|1-131:0| SEG 9->21|aaaaerlgparal| SEG 116->130|geggeggaaprrrpa| HM:PFM:NREP 2 HM:PFM:REP 80->116|PF04674|0.00051|22.2|36/273|Phi_1| HM:PFM:REP 44->71|PF06495|0.00072|32.1|28/182|Transformer| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 122-131| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccHHHHHHHHHcccccccHHHccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc //