[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68342.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.18.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   79->154 2z4fA PDBj 8e-04 39.2 %
:RPS:PDB   62->130 3bn6A PDBj 4e-07 24.6 %
:RPS:SCOP  52->129 1tvgA  b.18.1.9 * 9e-09 14.3 %
:HMM:SCOP  45->170 1k12A_ b.18.1.15 * 5.2e-07 20.6 %
:HMM:PFM   73->132 PF00754 * F5_F8_type_C 3.4e-12 33.3 60/129  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68342.1 GT:GENE BAC68342.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 785356..785871 GB:FROM 785356 GB:TO 785871 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF00754: F5/8 type C domain GB:PROTEIN_ID BAC68342.1 LENGTH 171 SQ:AASEQ MRSVTLKDLRDGTHRTLAARYVLDATETGELLHLAGVEHANGAESRATACPLADLALGRIVFPTAPLPPGMTDPRAAVDGDAGTAWSPGPDGRMVVDLDAEQHITEIRTQWRGGHAPASQVEFSRDGRTYGGAAQLSARGVLRTDSTPRDVALRVITSSAGPTSLIALTIA GT:EXON 1|1-171:0| BL:PDB:NREP 1 BL:PDB:REP 79->154|2z4fA|8e-04|39.2|74/161| RP:PDB:NREP 1 RP:PDB:REP 62->130|3bn6A|4e-07|24.6|69/158| HM:PFM:NREP 1 HM:PFM:REP 73->132|PF00754|3.4e-12|33.3|60/129|F5_F8_type_C| RP:SCP:NREP 1 RP:SCP:REP 52->129|1tvgA|9e-09|14.3|77/136|b.18.1.9| HM:SCP:REP 45->170|1k12A_|5.2e-07|20.6|126/0|b.18.1.15|1/1|Galactose-binding domain-like| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------------------------------------12------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 59.6 SQ:SECSTR ####################################################EEGGGGcEEccGGGcGGGcccGGGcTcccccccEEcccccTEEEEEEEEEEEEEEEEEcEEETTEEEEEEEEccccccEEcccTTcccEEEccccccccEEE################# DISOP:02AL 1-2| PSIPRED ccEEEHHHHcccccEEEEEEEEEEccccccEEEEEccccccccccEEEEccccHHHcccEEcccccccccccccccEEccccccccccccccEEEEEcccccEEEEEEEEEcccccccEEEEEEccccccccccEEEEEEEEEcccccEEEEEEEEEccccccEEEEEEEc //