[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68343.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68343.1 GT:GENE BAC68343.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 786451..786915 GB:FROM 786451 GB:TO 786915 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68343.1 LENGTH 154 SQ:AASEQ MEAIIASAVAVLGTLLGSGITLAFQRSTAERSHEFTRREKLRQERLDAYSAYAGALVNYRRCLVHLWFCIHEQPPPGDADEVRIRAYDLRSNTQEALFRVQMLTDDEALSQSAEAVLTDVTGLYKTDSRSELDERRAQTRDDISHLVRAAKQHL GT:EXON 1|1-154:0| TM:NTM 1 TM:REGION 3->25| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 31-39, 129-139, 153-154| PSIPRED cHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcc //