[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68357.1
DDBJ      :             putative sensor kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.274.1
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   157->205 2aswA PDBj 6e-06 16.3 %
:RPS:SCOP  160->205 2aswA1  a.274.1.1 * 2e-05 17.4 %
:HMM:PFM   139->205 PF00672 * HAMP 7.9e-16 37.9 66/70  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68357.1 GT:GENE BAC68357.1 GT:PRODUCT putative sensor kinase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(804165..804863) GB:FROM 804165 GB:TO 804863 GB:DIRECTION - GB:PRODUCT putative sensor kinase GB:NOTE frameshift GB:PROTEIN_ID BAC68357.1 LENGTH 232 SQ:AASEQ MVALAGLVIVARIDHRDRTDVDRQLTARAEKVRQDADKLLGQGDHEGADEGRDDYGGLLAGSQSLVRLISDGQVIAQRGETPPTPPPLPSRDGYSTIEADGQTWRTLTQPLNATGDRLEVLQDIDHIERRVADNTAIVVAVTLAAALATAVGVWLITRIILQPLQRLRTGALAISADTTGPQLPTVTGPQEVADLSRALNGMLANCAPAWKPPDASPPTPATSYVPPSPASA GT:EXON 1|1-232:0| SEG 81->89|tpptppplp| SEG 135->151|taivvavtlaaalatav| SEG 207->221|apawkppdaspptpa| RP:PDB:NREP 1 RP:PDB:REP 157->205|2aswA|6e-06|16.3|49/56| HM:PFM:NREP 1 HM:PFM:REP 139->205|PF00672|7.9e-16|37.9|66/70|HAMP| RP:SCP:NREP 1 RP:SCP:REP 160->205|2aswA1|2e-05|17.4|46/54|a.274.1.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 21.1 SQ:SECSTR ############################################################################################################################################################HHHHHHHHHHHHHHHHHHHTTcTTcccTTTTcccHHHHHHHHHHHHHHH########################### DISOP:02AL 37-52, 85-91, 229-232| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccEEEEEEccEEEEEccccccccHHHcccccHHHHHcccccEEEEEccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc //