[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68361.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->45 PF11268 * DUF3071 9.9e-05 30.6 36/170  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68361.1 GT:GENE BAC68361.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(808509..808670) GB:FROM 808509 GB:TO 808670 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68361.1 LENGTH 53 SQ:AASEQ MSDFGRIYGEEAATYAEMLPDSLAARPLDRATPWRTWRHRRRRWTPRSSHSRT GT:EXON 1|1-53:0| SEG 32->52|tpwrtwrhrrrrwtprsshsr| HM:PFM:NREP 1 HM:PFM:REP 10->45|PF11268|9.9e-05|30.6|36/170|DUF3071| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 43-53| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccc //