[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68371.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:226 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   94->105 PF05082 * DUF683 3.1e-05 75.0 12/66  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68371.1 GT:GENE BAC68371.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(818939..819619) GB:FROM 818939 GB:TO 819619 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68371.1 LENGTH 226 SQ:AASEQ MLLPRQTVQCALRDQSACGLASHGATFWPTTKQHESTTSRASGSTGQLRHNVTTAPGKSRCCLVGATAGLRASPPSGCRSRCRTSAHHFVDSYADMHDLAEDLPVPDGVPEAAATVLHTARELLRHSYVCYEFSAVAVMHFLIAVEIVLRDRIPDAGKKPLRKLIEQGAGAGVLTARQAEYLDYGRKIRNGMAHGQTTHTAMPPAVAVLMVTTSFAIVTEPCAPAL GT:EXON 1|1-226:0| TM:NTM 1 TM:REGION 129->150| HM:PFM:NREP 1 HM:PFM:REP 94->105|PF05082|3.1e-05|75.0|12/66|DUF683| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 34-47| PSIPRED ccccHHHHHHHHHccccccHHcccccccccccccccHHHHccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccc //