[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68372.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->69 PF11026 * DUF2721 4.1e-05 24.6 61/130  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68372.1 GT:GENE BAC68372.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(819960..820334) GB:FROM 819960 GB:TO 820334 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68372.1 LENGTH 124 SQ:AASEQ MATQVTATANAQRSASFLQIAIALQTLTIFLQAVSAGLLLTSSYGETLHSVGARVMYGASMLYVLAAVLAWKPGGGSPRPVWHASGFLVLASVQVLLGIAHVPSVHLPLGVLMFGLSVLALARR GT:EXON 1|1-124:0| TM:NTM 3 TM:REGION 19->41| TM:REGION 55->72| TM:REGION 91->113| HM:PFM:NREP 1 HM:PFM:REP 9->69|PF11026|4.1e-05|24.6|61/130|DUF2721| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcc //