[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68378.1
DDBJ      :             putative lyase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->155 1bh5B PDBj 4e-10 12.1 %
:RPS:SCOP  7->156 1sp9A  d.32.1.3 * 1e-11 15.4 %
:HMM:SCOP  1->148 1ss4A_ d.32.1.6 * 5.3e-18 35.3 %
:RPS:PFM   40->145 PF05548 * Peptidase_M11 7e-04 37.5 %
:HMM:PFM   5->144 PF00903 * Glyoxalase 2e-09 25.7 109/128  
:BLT:SWISS 8->148 YETH_BACSU 4e-05 31.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68378.1 GT:GENE BAC68378.1 GT:PRODUCT putative lyase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(826839..827309) GB:FROM 826839 GB:TO 827309 GB:DIRECTION - GB:PRODUCT putative lyase GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68378.1 LENGTH 156 SQ:AASEQ MNLKLEMIVLPVSDIDRAKAFYEKVGFRLDVDHTANEDFRIVHFTPPGSECSIIFGEGMTPIAPGSFQGLYLIVSDIEEARAELTGRGIEVSEIFHDAGGVFHGHEGGDVTHRGPGQERLAGLHPERASYGSFLTFSDPDGNGWVLQEVSQRLPGR GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 8->148|YETH_BACSU|4e-05|31.2|112/100| RP:PDB:NREP 1 RP:PDB:REP 4->155|1bh5B|4e-10|12.1|149/182| RP:PFM:NREP 1 RP:PFM:REP 40->145|PF05548|7e-04|37.5|88/250|Peptidase_M11| HM:PFM:NREP 1 HM:PFM:REP 5->144|PF00903|2e-09|25.7|109/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 7->156|1sp9A|1e-11|15.4|143/362|d.32.1.3| HM:SCP:REP 1->148|1ss4A_|5.3e-18|35.3|119/149|d.32.1.6|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 54 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- -12-2-------------------------------1232-----1-----1121--2--211----221------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------------------------1------1------21133221------------------------------------------------------------------------------------11-----------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEEcccHHHHHHHHHHTTccEEEEEEEETTTEEEEEEEcccGGGccccHHHHHHHHTTcccEEEEEEETTGGGcTTccccccccccccccEEEEEcccHHHHHHHHHHTTcEEEEcTTccccccEEEEEcTTccEEEEEEEEcGGGcT DISOP:02AL 153-156| PSIPRED cccEEEEEEEEEccHHHHHHHHHHHccEEEEEEEccccEEEEEEEcccccEEEEEEcccccccccccccEEEEEHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccccEEccccccccccEEEEEEEcccccEEEEEEEccccccc //