[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68381.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.6
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->45 2qs0A PDBj 4e-04 36.4 %
:RPS:SCOP  25->131 1ub4A  b.34.6.2 * 3e-11 21.1 %
:HMM:SCOP  25->133 1m1fA_ b.34.6.2 * 1.1e-07 26.3 %
:HMM:PFM   26->130 PF02452 * PemK 5.6e-11 26.5 98/110  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68381.1 GT:GENE BAC68381.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 829572..830048 GB:FROM 829572 GB:TO 830048 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF02452: PemK-like protein, IS701 family (830160..828223). Inverted repeat sequence (22/24 bp) GB:PROTEIN_ID BAC68381.1 LENGTH 158 SQ:AASEQ MAAPVSTPRQVAQRLPAVLCIGGLVQRGEVWWVQFDERRLVVLLSGDDASGFQVMQVVAPAGLDISGLGIEVTVGAGEGLPLEGVLRLAFPRPGFTPCTWLTTVSRDDLIERAAVLSSRKLSEIDDALRLAEQAQERTPATTAKLSEIRDALRRGELG GT:EXON 1|1-158:0| BL:PDB:NREP 1 BL:PDB:REP 1->45|2qs0A|4e-04|36.4|44/294| HM:PFM:NREP 1 HM:PFM:REP 26->130|PF02452|5.6e-11|26.5|98/110|PemK| RP:SCP:NREP 1 RP:SCP:REP 25->131|1ub4A|3e-11|21.1|95/103|b.34.6.2| HM:SCP:REP 25->133|1m1fA_|1.1e-07|26.3|99/0|b.34.6.2|1/1|Cell growth inhibitor/plasmid maintenance toxic component| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 44 STR:RPRED 27.8 SQ:SECSTR EEcTTccH#HHHTTccccccHHHHHHcTTcccEEEccHHHHHHHG################################################################################################################# DISOP:02AL 1-7, 156-158| PSIPRED cccccccHHHHHHHccHHHHHHHHHcccEEEEEEEccccEEEEEEccccccccEEEEEEccEEEEEccEEEEEEEcccccccccEEEEEEccccccEEEEEEEccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccc //