[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68382.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->55 PF08898 * DUF1843 0.00012 46.4 28/53  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68382.1 GT:GENE BAC68382.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 830486..830860 GB:FROM 830486 GB:TO 830860 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF07820: TraC-like protein GB:PROTEIN_ID BAC68382.1 LENGTH 124 SQ:AASEQ MIIRHIPGSPESRCRAGIASLLVWVMQRRVVLADRAERLRKELAEIDAEVARLEAAEVVIGQFIEAEGNGQADDPAVVQELERVTTTPGAGGMLLVPHREPDMDESALRDQQHPGIGPRQPCDL GT:EXON 1|1-124:0| SEG 48->59|aevarleaaevv| HM:PFM:NREP 1 HM:PFM:REP 27->55|PF08898|0.00012|46.4|28/53|DUF1843| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 5-7, 104-115, 123-124| PSIPRED cEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccEEEEccccccccHHHHHHcccccccccccccc //