[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68389.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->51 PF11423 * Repressor_Mnt 0.00036 63.6 11/30  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68389.1 GT:GENE BAC68389.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 836553..836768 GB:FROM 836553 GB:TO 836768 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68389.1 LENGTH 71 SQ:AASEQ MTVSKNINNPVGMGGGQRKKLSRAERQNNGPHRNLDRQGAADQKAELVRKMREKAGAAEGAGQAGDGSAQS GT:EXON 1|1-71:0| SEG 55->69|agaaegagqagdgsa| HM:PFM:NREP 1 HM:PFM:REP 41->51|PF11423|0.00036|63.6|11/30|Repressor_Mnt| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 12-41, 44-46, 49-71| PSIPRED cccccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccccccccc //