[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68391.1
DDBJ      :             putative phosphotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:248 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   150->186 1j7lA PDBj 1e-05 43.2 %
:RPS:SCOP  150->208 1j7iA  d.144.1.6 * 1e-10 32.2 %
:HMM:SCOP  1->222 1j7lA_ d.144.1.6 * 8.2e-24 28.9 %
:RPS:PFM   139->187 PF01636 * APH 2e-05 49.0 %
:HMM:PFM   17->207 PF01636 * APH 5.4e-23 27.6 185/238  
:BLT:SWISS 150->186 KKA3_ENTFA 3e-05 43.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68391.1 GT:GENE BAC68391.1 GT:PRODUCT putative phosphotransferase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 837899..838645 GB:FROM 837899 GB:TO 838645 GB:DIRECTION + GB:PRODUCT putative phosphotransferase GB:NOTE PF01636: Phosphotransferase enzyme family GB:PROTEIN_ID BAC68391.1 LENGTH 248 SQ:AASEQ MDEVEVVVAHSERATLRVGDVFLKVDADQARIDVEVEAMSLAPVPTPEVLWRKPPVLAIAALPGTTLGRLGGPSTGSSAAWAAAGTAIRKLHDAPLPPRAGRAGRSIVALAAELDAECELLVTNGLLPADLVTRNRQVAEAALRPWTAAFTHGDLQIAHVFVEGNEVTGIIDWSEAGQGDALYDLATFTLGHEEHLDDVVAGYGTDIDLDVIHAWWSLRSLLVVRWLTEHGFDPFAPGCEVDVLRSRM GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 150->186|KKA3_ENTFA|3e-05|43.2|37/264| SEG 62->87|lpgttlgrlggpstgssaawaaagta| SEG 109->121|alaaeldaecell| BL:PDB:NREP 1 BL:PDB:REP 150->186|1j7lA|1e-05|43.2|37/263| RP:PFM:NREP 1 RP:PFM:REP 139->187|PF01636|2e-05|49.0|49/221|APH| HM:PFM:NREP 1 HM:PFM:REP 17->207|PF01636|5.4e-23|27.6|185/238|APH| RP:SCP:NREP 1 RP:SCP:REP 150->208|1j7iA|1e-10|32.2|59/260|d.144.1.6| HM:SCP:REP 1->222|1j7lA_|8.2e-24|28.9|218/263|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------------1------------------1--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 14.9 SQ:SECSTR #####################################################################################################################################################EEcccccTTcEEEETTEEEEEcccTTcEEEEHHHHHH############################################################## PSIPRED cccEEEEEEEcccEEEEEEEEEEEEEccccEEEEEEEEEccccccccHHHHccccEEEEEEcccccHHccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHccHHHHHHHccccEEEEEEccccEEEEEEEcccEEEEEEccccccccccHHHHHcccccHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcc //