[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68394.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->51 PF01609 * Transposase_11 1.6e-05 31.2 32/207  
:BLT:SWISS 3->58 T112_STRAL 1e-25 83.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68394.1 GT:GENE BAC68394.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(839489..839665) GB:FROM 839489 GB:TO 839665 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68394.1 LENGTH 58 SQ:AASEQ MAWIEAHNRSHRQVGARVEHVFARMKTWKILRDCRLNGDGVHHAMLGIARLHNFALAG GT:EXON 1|1-58:0| BL:SWS:NREP 1 BL:SWS:REP 3->58|T112_STRAL|1e-25|83.9|56/100| HM:PFM:NREP 1 HM:PFM:REP 17->51|PF01609|1.6e-05|31.2|32/207|Transposase_11| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1--------------------1--2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 11-12| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccc //