[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68395.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   95->136 PF01609 * Transposase_11 3.2e-06 38.5 39/207  
:BLT:SWISS 39->141 T112_STRAL 7e-44 77.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68395.1 GT:GENE BAC68395.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(839801..840232) GB:FROM 839801 GB:TO 840232 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68395.1 LENGTH 143 SQ:AASEQ MDSPVHGAESASATAPGAGERTAARGRRCGPLRTALGPPFQDRVMLVVTYWRTNLTMRQLAPLFGGWKSAADQVIDQLGPHLALQPRRRFRNDAVLIVDGTLVPTRDRTVAKQSKNYRHSTNHQVVIDADSRLVVVIGRPLPR GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 39->141|T112_STRAL|7e-44|77.7|103/100| SEG 13->30|atapgagertaargrrcg| HM:PFM:NREP 1 HM:PFM:REP 95->136|PF01609|3.2e-06|38.5|39/207|Transposase_11| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1--------------------1-121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21| PSIPRED cccccccccccccccccccccHHHcccccccEEEcccccccccEEEEEEEEcccccHHHHHHHHcccHHHHHHHHHHHcccccHHHHHccccccEEEEEccccccccHHHHHHccccEEEcccEEEEEcccEEEEEEcccccc //