[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68396.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->73 PF05955 * Herpes_gp2 4.1e-05 36.5 63/797  
:PROS 49->64|PS00012|PHOSPHOPANTETHEINE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68396.1 GT:GENE BAC68396.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 840508..840777 GB:FROM 840508 GB:TO 840777 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68396.1 LENGTH 89 SQ:AASEQ MSLLLQRPPAPSTRACSFNNGTWAPKQITLPEDLLTVPATGEAGHGTGRTGGSSTSPAGSVRSLTALAPARNTSGPVLRWEGRELARLA GT:EXON 1|1-89:0| PROS 49->64|PS00012|PHOSPHOPANTETHEINE|PDOC00012| SEG 39->60|atgeaghgtgrtggsstspags| HM:PFM:NREP 1 HM:PFM:REP 9->73|PF05955|4.1e-05|36.5|63/797|Herpes_gp2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 46-58| PSIPRED ccccccccccccccEEEcccccccccEEEcccHHEEccccccccccccccccccccccccccEEEEEcccccccccEEEEccccccccc //