[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68398.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   28->66 3cf4A PDBj 4e-07 12.8 %
:HMM:PFM   16->73 PF07200 * Mod_r 0.00014 20.7 58/150  
:BLT:SWISS 33->84 SYS_RHOBA 2e-04 30.8 %
:REPEAT 2|25->49|50->72

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68398.1 GT:GENE BAC68398.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 842362..842616 GB:FROM 842362 GB:TO 842616 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68398.1 LENGTH 84 SQ:AASEQ MRAPEGTASLVRPALPVHKGVIMSATDPTRGSAQQMRQKVQEMEEAAQRASDPQERQKLQDKARKLREQSERQGGQSEGIDPTI GT:EXON 1|1-84:0| BL:SWS:NREP 1 BL:SWS:REP 33->84|SYS_RHOBA|2e-04|30.8|52/426| NREPEAT 1 REPEAT 2|25->49|50->72| RP:PDB:NREP 1 RP:PDB:REP 28->66|3cf4A|4e-07|12.8|39/766| HM:PFM:NREP 1 HM:PFM:REP 16->73|PF07200|0.00014|20.7|58/150|Mod_r| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 39 STR:RPRED 46.4 SQ:SECSTR ###########################cGGGcccTTHHHHHHHHHHHccEEETTTTEEEEcccccc################## DISOP:02AL 1-7, 29-84| PSIPRED ccccccHHHHHHHHHHHHccEEccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccc //