[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68399.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68399.1 GT:GENE BAC68399.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(842970..843443) GB:FROM 842970 GB:TO 843443 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68399.1 LENGTH 157 SQ:AASEQ MRWRLRPLIFLPASMPWLVSATFADVFTLCASTTAAVGPALWPCARRVLSRSGSRTCWVVPSDSHFRPYRSDVSDARWAWAGPGTAARVHDLREIVNAILYVNRTGIPWEYLRHDFPPFKTVYDYYADEHSHPMQQPPTAPVTKTSQNTNYPDQKPP GT:EXON 1|1-157:0| TM:NTM 1 TM:REGION 13->35| OP:NHOMO 65 OP:NHOMOORG 16 OP:PATTERN --------------------------------------------------2----------------- ---------------------------------------1-276-----------------3-----16-----------------------------------------------------------------------------------------------B---7----------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---2----------------------------------------2----------------------------------------------------------------------------------B-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 55-67, 148-150, 152-157| PSIPRED ccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccc //