[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68403.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   220->267 PF07382 * HC2 1.8e-07 55.6 45/194  
:HMM:PFM   97->238 PF04147 * Nop14 0.0002 41.4 87/839  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68403.1 GT:GENE BAC68403.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(846848..847663) GB:FROM 846848 GB:TO 847663 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF04871: Uso1 / p115 like vesicle tethering protein, C terminal region GB:PROTEIN_ID BAC68403.1 LENGTH 271 SQ:AASEQ MADVPKIALAAAVLGGYVVGRTKKGRVAFAMATYLAGRRFGLEPQQLLAEGVKRLRELPQFADLNEQLRGEVLEAGRKAMTTAADRKLADLADSLHQRTERMGSKGKEEPQDDEEPEEGDEEEEVPEGEEPEEGEGEEAEDEYEEDEEEEPEEEPGEDEEEPEGEQEPEEEEEPEEEEEPEEEEEPERPASRRRRAARKPDDDSDGGSRRGRGGARRPERAAARKAPAKKSAPAKKTSAARKSSASPKKSPVKKSAAKKTAAKKASSRRRR GT:EXON 1|1-271:0| SEG 8->20|alaaavlggyvvg| SEG 108->270|eepqddeepeegdeeeevpegeepeegegeeaedeyeedeeeepeeepgedeeepegeqepeeeeepeeeeepeeeeeperpasrrrraarkpdddsdggsrrgrggarrperaaarkapakksapakktsaarkssaspkkspvkksaakktaakkassrrr| HM:PFM:NREP 2 HM:PFM:REP 220->267|PF07382|1.8e-07|55.6|45/194|HC2| HM:PFM:REP 97->238|PF04147|0.0002|41.4|87/839|Nop14| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 39-271| PSIPRED cccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHcccHHHHHHHHHcccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccc //