[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68404.1
DDBJ      :             putative ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  77/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:258 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->222 PF01061 * ABC2_membrane 1e-09 27.4 %
:HMM:PFM   13->222 PF01061 * ABC2_membrane 2.9e-30 29.1 196/208  
:BLT:SWISS 7->239 DRRB_STRPE 4e-20 26.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68404.1 GT:GENE BAC68404.1 GT:PRODUCT putative ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(848379..849155) GB:FROM 848379 GB:TO 849155 GB:DIRECTION - GB:PRODUCT putative ABC transporter permease protein GB:NOTE PF01061: ABC-2 type transporter GB:PROTEIN_ID BAC68404.1 LENGTH 258 SQ:AASEQ MSSFSLAVRDSSTMLRRNLLHARRYPSLTLNLLLTPVMLLLLFVYIFGDTMSGGAGRSAYIAYIVPGILLMTIGSTTIGTAVSVSTDMNEGIIARFRTMAIHRSSVLFGHVAGSVLQAIMSVVLVGAVGVAMGFRSTDATVLEWLAAFGLLALFALAFTWIAVGMGLGSPNAEAASNNAMPLILLPLISSAFVPLDSMPGWFQPIAEYQPFTPAIETLRGLLLGTEIGNNWWIALAWCLGLTVLGHRWSKAQFNRDPK GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 7->239|DRRB_STRPE|4e-20|26.4|227/283| TM:NTM 6 TM:REGION 28->50| TM:REGION 62->84| TM:REGION 103->125| TM:REGION 144->166| TM:REGION 175->197| TM:REGION 221->243| SEG 28->42|ltlnllltpvmllll| SEG 122->131|vvlvgavgva| SEG 145->158|laafgllalfalaf| RP:PFM:NREP 1 RP:PFM:REP 14->222|PF01061|1e-09|27.4|197/208|ABC2_membrane| HM:PFM:NREP 1 HM:PFM:REP 13->222|PF01061|2.9e-30|29.1|196/208|ABC2_membrane| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01061|IPR013525| OP:NHOMO 152 OP:NHOMOORG 81 OP:PATTERN --------------------------------------------1---1-11---------------- 1--17----------1-----111--------12227545142525-2-1--12---1--521-24247A-------------------------------------------------------------------------------------------------------------------------1--11111111-11111111----111-11----111111-3----------------------1--------11----1------11-------------------------------------------------------------11---------------1------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 256-258| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHcHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc //