[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68405.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  902/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:321 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   5->224 1vplA PDBj 3e-27 32.7 %
:RPS:PDB   5->223 3b5jA PDBj 1e-39 26.3 %
:RPS:SCOP  6->223 1b0uA  c.37.1.12 * 3e-39 23.9 %
:HMM:SCOP  10->218 1ii8.1 c.37.1.12 * 4.1e-61 40.6 %
:RPS:PFM   45->165 PF00005 * ABC_tran 1e-07 31.1 %
:HMM:PFM   45->165 PF00005 * ABC_tran 1.2e-16 30.1 113/118  
:HMM:PFM   33->54 PF03215 * Rad17 0.00013 50.0 22/498  
:BLT:SWISS 5->319 DRRA_STRPE 1e-65 42.8 %
:PROS 137->151|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68405.1 GT:GENE BAC68405.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(849152..850117) GB:FROM 849152 GB:TO 850117 GB:DIRECTION - GB:PRODUCT putative ABC transporter ATP-binding protein GB:NOTE PF00005: ABC transporter GB:PROTEIN_ID BAC68405.1 LENGTH 321 SQ:AASEQ MTNLAIAANGLRKSYGDKTVLDGIDLSIPAGSVFALLGPNGAGKTTAVKILSTLITADGGQAQVAGHDLAAEAHAVRAAIGVTGQFSAVDGLITGEENMLLMADLHHLPKSEGQRVTAELLERFDLVEAAKKPASTYSGGMKRRLDIAMTLVGSPRIIFLDEPTTGLDPRSRHNMWQIIRELVTGGVTVFLTTQYLEEADELADRIAVLSDGKIAAQGTADELKRIVPGGHVRLRFTDPAAYQSAASALREGTRDDEALSLQIPSDGSQRALRSLLDQLDAAGIEADELTVHTPDLDDVFFALTGSTTVPAQPNQPKEAVR GT:EXON 1|1-321:0| BL:SWS:NREP 1 BL:SWS:REP 5->319|DRRA_STRPE|1e-65|42.8|311/330| PROS 137->151|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 182->193|lvtggvtvfltt| BL:PDB:NREP 1 BL:PDB:REP 5->224|1vplA|3e-27|32.7|220/238| RP:PDB:NREP 1 RP:PDB:REP 5->223|3b5jA|1e-39|26.3|217/243| RP:PFM:NREP 1 RP:PFM:REP 45->165|PF00005|1e-07|31.1|119/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 45->165|PF00005|1.2e-16|30.1|113/118|ABC_tran| HM:PFM:REP 33->54|PF03215|0.00013|50.0|22/498|Rad17| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 6->223|1b0uA|3e-39|23.9|218/258|c.37.1.12| HM:SCP:REP 10->218|1ii8.1|4.1e-61|40.6|207/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 40540 OP:NHOMOORG 1165 OP:PATTERN TTEALMDGIKIHKINHgEPPLNPWrMQZkUcTC7AAC8CCECAQSJWcKN*ma7MWKQWLMEFCR167 RWrM*XTXddfXUSPNRLL-Ld99W*MMMMMMollnv***T*X*h*sfogbJ*wuKOdBBxx*f*s****dVSSSxYUSJrag95858NNKH3GCHB--BGOIHJXKUQK54555544757777FNGFLOGGKKQLijjtlJIJublWemYYfVaPQIDJGJGWcUfrutLALBABBBKCADAfVYQNWO8Sdt********s**********uy***cmr*teqnopnmp**TaacacZYZZbbaZZRURWTnUWRtqQLPNTsrJKvzYPNVcYXZaggjjhfnlnkhfeheffkghfWWUUVWWWYXVVWlfgWWVjikgd*mz********e*fk*rrXZbX*hfdZ*fkPH**bdXbgaQYbTbdGRQYIeVRRKHIFEIXO***SJk**********y*z***-dk*aU*gz**O8**************GGJ********y*NMNNNNNNqXbGOiTw66345444233353444552544467565FABDA8***********rtstn*****w**j*******y8Husi*cpiq*x****ShbIQGEdUGGHFGGHNIPTklas*MYTnYOdkVXfHYYWQSTdOWXcVYqyTyCFGHACCEEBB786776866CJBAEIHceoIiUQENDiKLMOLINUOKMOJNRRQPT4-AHMIM------zm**N*nosrrourvkn-qlnnsoronoruolknllj*****aaSfgcfdhfhgecfgffb*hdejkhlL4************23GEBCABCEGIGKLvh*QQQWRPDDHDDMJNWLMONMFOCJJfYopnoo***k**sod***8BC8BCCCBLRaXjZaZaaklkfhPNOJKKJJMKGECE33HNNNCDHI76656654jBJ96838-646687578846A655555SbfNMYmaaXAZL -111YXF-QG7FJRLE9C9CEHFJCLIBBAA89CB85DBAB89B98FBCFDCJJCBA89667937232144265622-3255455911-AF69A977776616NKF2NaVZNUReSTEGF6FMGijBhD**b4ZKeHFHAWDIWPCJDFGSGC*ETNJjDT*IaJXCyTW*MYQADJH9*A79IGhUS*B*jGE*r**T ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 305-321| PSIPRED ccccEEEEEEEEEEEccEEEEEccEEEEEccEEEEEEccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHEEcccEEEEEEEEcccHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHccccccccccccccccc //