[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68406.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:223 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->81 PF00011 * HSP20 0.00073 24.2 33/102  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68406.1 GT:GENE BAC68406.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(850165..850836) GB:FROM 850165 GB:TO 850836 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68406.1 LENGTH 223 SQ:AASEQ MQKFDTPAPVSAVVDIPAGRIQFIAADRADTTIEVLPANAAKSRDVKAAEEITVSYSDGVLRIGAPQAKNRALGHSGSVEVTVQLPAGSHIEAKAAAAEFRGVGRLGDVVFAGGYRSVKLDEAASARLTGLDADITVGRLNGPGEISTQKGDLNIAEAARGTLTLSTQMGDIVVGAARGVSAALDAGTSYGRINNTLQNTDGAAAGLTIHATTAHGDITARSL GT:EXON 1|1-223:0| HM:PFM:NREP 1 HM:PFM:REP 49->81|PF00011|0.00073|24.2|33/102|HSP20| OP:NHOMO 24 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ----5---------1---------------------1112-211-1------1---------1-111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 222-223| PSIPRED cccccccccEEEEEEEcccEEEEEEccccccEEEEEEccccccccHHEEEEEEEEEcccEEEEccccccccccccccEEEEEEEEcccccHHHHHHHEEEEEccccccEEEEcccEEEEEccccEEEEEEEcccEEEEcccccEEEEEEcccEEEEEEEEEEEEEEEEEEEEEEEEccccEEEEcccEEEccccccccccccccccEEEEEEEccccEEEEcc //