[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68415.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  184/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:210 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->62 2i10A PDBj 1e-08 42.6 %
:RPS:PDB   10->145 3br2E PDBj 5e-14 14.3 %
:RPS:SCOP  10->74 1z77A1  a.4.1.9 * 8e-11 21.5 %
:RPS:SCOP  84->145 1sgmA2  a.121.1.1 * 5e-06 9.7 %
:HMM:SCOP  1->84 1t33A1 a.4.1.9 * 1.8e-14 33.7 %
:HMM:SCOP  78->193 2i10A2 a.121.1.1 * 1.3e-26 42.2 %
:HMM:PFM   13->57 PF00440 * TetR_N 3e-12 31.1 45/47  
:BLT:SWISS 1->143 YEZE_BACSU 2e-09 30.3 %
:PROS 24->54|PS01081|HTH_TETR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68415.1 GT:GENE BAC68415.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 860134..860766 GB:FROM 860134 GB:TO 860766 GB:DIRECTION + GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC68415.1 LENGTH 210 SQ:AASEQ MARPRQFDEEEVVRAARDQFWSVGYNGTSIDDLSAVTGLGRGSLYGAFEDKHALFLRALDSYNSDALRAWRTALGGPGPALPMLERHVRNVADGIIGDVERRGCMMAKIAAELSAVDEGVAERIAAVVRGLHGALRGCITRAQAEGSLDADADPDSLASLLLAVLRGLEALGKAGATPEVVNGAAEQALALLPRVSPDEHAPGTRSSTGA GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 1->143|YEZE_BACSU|2e-09|30.3|142/194| PROS 24->54|PS01081|HTH_TETR_1|PDOC00830| SEG 146->172|gsldadadpdslaslllavlrglealg| BL:PDB:NREP 1 BL:PDB:REP 9->62|2i10A|1e-08|42.6|54/173| RP:PDB:NREP 1 RP:PDB:REP 10->145|3br2E|5e-14|14.3|133/187| HM:PFM:NREP 1 HM:PFM:REP 13->57|PF00440|3e-12|31.1|45/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 10->74|1z77A1|8e-11|21.5|65/75|a.4.1.9| RP:SCP:REP 84->145|1sgmA2|5e-06|9.7|62/111|a.121.1.1| HM:SCP:REP 1->84|1t33A1|1.8e-14|33.7|83/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 78->193|2i10A2|1.3e-26|42.2|116/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 299 OP:NHOMOORG 184 OP:PATTERN -------------------------------------------------------------------- ----2----------------1--12------322221111---3--11--1-----1------3-6282-------------------------------2---5121-----------------------------------2-3-1--------------1--1--------------------------1-------1-11--111-111---2-------------23-------------------------------11-------------------------------------------------------------1---------------------------------------------2-22--1-----31523---11-2--------------1211111-21-411123-65512-2-1-12-----22-11111111-11----1---------------------------------2--11133334222----1131------41321-1--11---------1-1-1---11-------------------------------1-------111111-----------------------------11----111--1222222-211212-1211---------------11------------------------------------1--------------------2-------2----------------------------1-------------------1111-11-1-11-1-21-----------------------211111111-1------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 69.0 SQ:SECSTR cTccccTTHHHHHHHHHHHHHHHcTTTccHHHHHHHTTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHccHHHccGGGHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHTT################################################################# DISOP:02AL 1-6, 201-210| PSIPRED ccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHccccccccccc //