[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68417.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.5.1
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->181 2vq3A PDBj 4e-13 36.3 %
:RPS:PDB   22->174 3cmmC PDBj 2e-07 14.8 %
:RPS:SCOP  22->106 1e0dA1  c.5.1.1 * 3e-07 14.1 %
:HMM:SCOP  17->203 1jayA_ c.2.1.6 * 9.5e-27 37.3 %
:RPS:PFM   23->86 PF03807 * F420_oxidored 1e-04 32.8 %
:HMM:PFM   22->111 PF03807 * F420_oxidored 3.4e-24 37.8 90/96  
:BLT:SWISS 23->181 STEA3_HUMAN 1e-12 36.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68417.1 GT:GENE BAC68417.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(862181..862846) GB:FROM 862181 GB:TO 862846 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03807: NADP oxidoreductase coenzyme F420-dependent GB:PROTEIN_ID BAC68417.1 LENGTH 221 SQ:AASEQ MPGSPRGLCTRSRKSTMSTHGTIGVLGAGEVGQAVADKAVRHGHEVLIGNSRGPRTLEALVGRLGPKARAVTAEEAVQPELVFLSVPFFAVPELTGLTTWAGKIVVDTTNQFAAANPWRGRYDVGDLTGSEWVARHLPGARLVKALNTLFATFIAADPRHAEGRQVAFYAGDDADAKTAVAGLLDEFGFAALDLGGLRDGGRLMQLDGALSAKHLLLQDVG GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 23->181|STEA3_HUMAN|1e-12|36.3|146/488| SEG 187->203|fgfaaldlgglrdggrl| BL:PDB:NREP 1 BL:PDB:REP 23->181|2vq3A|4e-13|36.3|146/181| RP:PDB:NREP 1 RP:PDB:REP 22->174|3cmmC|2e-07|14.8|128/1006| RP:PFM:NREP 1 RP:PFM:REP 23->86|PF03807|1e-04|32.8|64/96|F420_oxidored| HM:PFM:NREP 1 HM:PFM:REP 22->111|PF03807|3.4e-24|37.8|90/96|F420_oxidored| RP:SCP:NREP 1 RP:SCP:REP 22->106|1e0dA1|3e-07|14.1|85/93|c.5.1.1| HM:SCP:REP 17->203|1jayA_|9.5e-27|37.3|177/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 155 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------------------------- -12----1111-----1--------------------------34----21-111---------2--1321-----------1---------------------------------------------------1---------2-1-----------------------------------------------------1--------------------------------------------------------22-----22--22-----1----------------------------------------------------------------------------------------------------1--------111---------------------------111-2--4111--113131------------------------21----1----------------------------------------1---1--------21--------2-121----1-------1-1-----1--------------------------------1----------1-------1--------------------------1-------------------------------------------2------------------------------------21------------------------------------------------------------------------------------31------312-----2-1----------------------------------1---------11--------------------------------------------------- -------------------------------------------------1-----------------------1-----------------------------------32---------------1--7A3-1-3----------------------1-----------------------------------2--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 81.0 SQ:SECSTR ######HHHHHHHHTTcccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccccccGGGGGTcTTTccHHHHHHHHcTTccEEEcccGGGHHHHHHHHTTcTTccEEEccccccGGGGGGccEEEcTTccHHHHHGcHHHHHHHHHHHHTcEEEEEEEETTEEEEEEEccccEEGcTTTcTTHHH#################################### DISOP:02AL 1-3, 8-22| PSIPRED ccccccHHcccccccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHccEEEEccHHHHHHccEEEEEEccccHHHHHHHccccccEEEEcccccccccccccccccccccHHHHHHHHcccccHHHHHHccccHHHccccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEcccHHHHHHHHcccccccHHHHHHHHcc //