[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68420.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:67 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->56 1dwqA PDBj 9e-07 15.1 %
:RPS:SCOP  1->56 1azwA  c.69.1.7 * 1e-07 16.1 %
:HMM:SCOP  3->60 1mtzA_ c.69.1.7 * 1.2e-08 26.3 %
:HMM:PFM   3->57 PF00561 * Abhydrolase_1 2.9e-07 27.3 55/231  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68420.1 GT:GENE BAC68420.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(864970..865173) GB:FROM 864970 GB:TO 865173 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68420.1 LENGTH 67 SQ:AASEQ MRDMPVLNTAGEEDSQFPVHVVRKMTDAIEGSTLRLLQHTAHLAARTNPEGVNAEIDAFLAALPAAA GT:EXON 1|1-67:0| SEG 58->66|aflaalpaa| RP:PDB:NREP 1 RP:PDB:REP 4->56|1dwqA|9e-07|15.1|53/261| HM:PFM:NREP 1 HM:PFM:REP 3->57|PF00561|2.9e-07|27.3|55/231|Abhydrolase_1| RP:SCP:NREP 1 RP:SCP:REP 1->56|1azwA|1e-07|16.1|56/313|c.69.1.7| HM:SCP:REP 3->60|1mtzA_|1.2e-08|26.3|57/290|c.69.1.7|1/1|alpha/beta-Hydrolases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 57 STR:RPRED 85.1 SQ:SECSTR GTcccEEEEEcTTcccccHHHHHHHHHHccccEEEEcccccccHHHHcHHHHHHHHH########## DISOP:02AL 1-3| PSIPRED cccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccc //