[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68425.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  88/199 : Viruses  0/175   --->[See Alignment]
b.68.5b.68.6
:301 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   41->155 1npeA PDBj 1e-11 37.0 %
:RPS:PDB   39->212 2aazA PDBj 1e-16 9.9 %
:RPS:SCOP  21->214 1npeA  b.68.5.1 * 1e-31 29.3 %
:HMM:SCOP  14->292 1v04A_ b.68.6.2 * 3.9e-30 29.1 %
:HMM:PFM   49->80 PF00058 * Ldl_recept_b 1.9e-05 42.9 28/43  
:HMM:PFM   98->269 PF08450 * SGL 0.00042 24.6 142/246  
:BLT:SWISS 6->212 LRP5_HUMAN 4e-15 30.2 %
:BLT:SWISS 197->278 NID1_HUMAN 1e-04 32.5 %
:REPEAT 3|51->104|152->202|208->252

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68425.1 GT:GENE BAC68425.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(867789..868694) GB:FROM 867789 GB:TO 868694 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00058: Low-density lipoprotein receptor repeat class B GB:PROTEIN_ID BAC68425.1 LENGTH 301 SQ:AASEQ MTQRQERLFVLEASSGGRLFSVNPDGSDKKVIVTGCRIPDGVAIDVLAGHVYWTNMGLPPENDGSIERVDLDGGNRTTIVPSGVTHTPKQLYLEAVGRKLYWGDREGMRVMRCDLDGSHVETLVQTGQGEDDRRDETRWCVGVAVDPAGGHLYWTQKGPSDAGLGKILRAGISLPAGESAAERGDIEVLFEGLPEPIDLELDLAERMLYWTDRGDPPRGNSVNRSPMHPPDAQRTPEILLTHLMEAIGIALDPDGGRMYVTDLAGNVYAAGLDGSNRREILVAQGNLTGIAHAVLPTGTSF GT:EXON 1|1-301:0| BL:SWS:NREP 2 BL:SWS:REP 6->212|LRP5_HUMAN|4e-15|30.2|179/1615| BL:SWS:REP 197->278|NID1_HUMAN|1e-04|32.5|75/1247| NREPEAT 1 REPEAT 3|51->104|152->202|208->252| BL:PDB:NREP 1 BL:PDB:REP 41->155|1npeA|1e-11|37.0|100/263| RP:PDB:NREP 1 RP:PDB:REP 39->212|2aazA|1e-16|9.9|161/305| HM:PFM:NREP 2 HM:PFM:REP 49->80|PF00058|1.9e-05|42.9|28/43|Ldl_recept_b| HM:PFM:REP 98->269|PF08450|0.00042|24.6|142/246|SGL| RP:SCP:NREP 1 RP:SCP:REP 21->214|1npeA|1e-31|29.3|167/263|b.68.5.1| HM:SCP:REP 14->292|1v04A_|3.9e-30|29.1|254/0|b.68.6.2|1/1|Calcium-dependent phosphotriesterase| OP:NHOMO 458 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------------------------- --------------1----------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1---------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------2-------11121113432-------------------1-121212--1--222------------------------------1-----------------b6AAC695434458875846T5163A17445455534534743D3C7753AC268431235819------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 94.4 SQ:SECSTR ###############EEEEEEEETHHHHHHHHHHcccEcccTHHHHTTTccTTHHHHcHHHHHHTTcTTccTTcccccHHHHHHTHcTcccccTTcccTTccccHHHHHHHHHHHcTTccccEEEcccTTTGGGccccccEEGGGccccccEEEEEcTTcTTcccEEEEEEEEEEEETTTHHHHHHHHHHHcHHHHHHHHHTcEEEEEEEEETTcccEEETTTEEccTTcccTTcccccccccccEEEEEEccccTTEEEEEETTEEEETTTTEEEcGGGGcTTTcccEEEEEEccccc## PSIPRED ccccccEEEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEEEEccEEEEEEcccccccccEEEEEEcccccEEEEEEccccccccEEEEEEEccEEEEEEccccEEEEEEcccccEEEEEEccccccccccccccccEEEEcccccEEEEEEccccccccEEEEEEcccccEEEEcccccEEEEEEccccccEEEEEEccccEEEEEEccccccEEEEEEEEEcccccccEEEEEEccccccEEEEEEEEccEEEEEEccccEEEEEcccccEEEEEEEccccccEEEEEccccccc //