[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68432.1
DDBJ      :             putative AraC-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1
:80 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->64 2k9sA PDBj 2e-04 28.1 %
:RPS:PDB   1->69 1bl0A PDBj 2e-11 21.7 %
:RPS:SCOP  18->68 1bl0A2  a.4.1.8 * 2e-09 19.6 %
:HMM:SCOP  17->81 1d5yA2 a.4.1.8 * 1.3e-09 27.7 %
:RPS:PFM   29->64 PF00165 * HTH_AraC 2e-04 41.7 %
:HMM:PFM   3->14 PF00165 * HTH_AraC 0.00035 41.7 12/42  
:HMM:PFM   29->65 PF00165 * HTH_AraC 3.2e-10 36.1 36/42  
:BLT:SWISS 8->75 MELR_ECOLI 5e-07 33.8 %
:PROS 18->60|PS00041|HTH_ARAC_FAMILY_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68432.1 GT:GENE BAC68432.1 GT:PRODUCT putative AraC-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 875568..875810 GB:FROM 875568 GB:TO 875810 GB:DIRECTION + GB:PRODUCT putative AraC-family transcriptional regulator GB:NOTE truncated GB:PROTEIN_ID BAC68432.1 LENGTH 80 SQ:AASEQ MWRQETGITPHQWLLTARINHARELLEVTDLGIEQIAAQSGLGTSTNLRARFRDTLGTTPSAYRRTFQETTMAGPQTRQK GT:EXON 1|1-80:0| BL:SWS:NREP 1 BL:SWS:REP 8->75|MELR_ECOLI|5e-07|33.8|68/302| PROS 18->60|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| BL:PDB:NREP 1 BL:PDB:REP 1->64|2k9sA|2e-04|28.1|64/107| RP:PDB:NREP 1 RP:PDB:REP 1->69|1bl0A|2e-11|21.7|69/116| RP:PFM:NREP 1 RP:PFM:REP 29->64|PF00165|2e-04|41.7|36/40|HTH_AraC| HM:PFM:NREP 2 HM:PFM:REP 3->14|PF00165|0.00035|41.7|12/42|HTH_AraC| HM:PFM:REP 29->65|PF00165|3.2e-10|36.1|36/42|HTH_AraC| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 1 RP:SCP:REP 18->68|1bl0A2|2e-09|19.6|51/62|a.4.1.8| HM:SCP:REP 17->81|1d5yA2|1.3e-09|27.7|65/0|a.4.1.8|1/1|Homeodomain-like| OP:NHOMO 180 OP:NHOMOORG 96 OP:PATTERN -------------------------------------------------------------------- ----6---------3------1---3------22224354-31611------111-----311-4-7C95-----------------------------------1--------------------------------------1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------1---11-----------------------------1-----1----1--1---11-111--1----------------------1---------------------------------------1-----12333324-1---2211-11--123111----11------1-1----1---1------------------------1--------1-------------------------------------------1--------------------1----------------------1-1--------------------------------------------------------------------------------------------1--------------------1------------1111-1-11-111------------------------111---------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 86.2 SQ:SECSTR HHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTcccc########### DISOP:02AL 64-80| PSIPRED ccHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHccccccccccc //