[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68433.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->54 1rjwA PDBj 5e-06 33.3 %
:RPS:PDB   6->54 2cf5A PDBj 6e-08 24.5 %
:BLT:SWISS 9->53 ADHA_BACSU 6e-07 35.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68433.1 GT:GENE BAC68433.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 875850..876020 GB:FROM 875850 GB:TO 876020 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68433.1 LENGTH 56 SQ:AASEQ MAAARMSRKDVEDTMAFSALHGIRPMTEIVPLDRADEAYQKMLAGKARFRMVLTAG GT:EXON 1|1-56:0| BL:SWS:NREP 1 BL:SWS:REP 9->53|ADHA_BACSU|6e-07|35.6|45/349| BL:PDB:NREP 1 BL:PDB:REP 7->54|1rjwA|5e-06|33.3|48/339| RP:PDB:NREP 1 RP:PDB:REP 6->54|2cf5A|6e-08|24.5|49/352| OP:NHOMO 9 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -1------------------------------1----------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------1--------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 92.9 SQ:SECSTR ####cccHHHHHHHHHHHHHTTccccEEEEEGGGHHHHHHHHHTTccccEEEEEcc DISOP:02AL 1-4| PSIPRED cccccccHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHHccccEEEEEEcc //