[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68439.1
DDBJ      :             putative LysR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  279/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->244 2esnC PDBj 3e-15 29.5 %
:RPS:PDB   25->241 1b9nB PDBj 1e-08 9.5 %
:RPS:SCOP  25->86 2esnA1  a.4.5.37 * 1e-10 43.5 %
:RPS:SCOP  127->310 1utbA  c.94.1.1 * 1e-17 21.5 %
:HMM:SCOP  6->94 2esnA1 a.4.5.37 * 2.6e-14 31.5 %
:HMM:SCOP  96->309 2esnA2 c.94.1.1 * 1.4e-34 32.9 %
:HMM:PFM   99->309 PF03466 * LysR_substrate 1e-24 24.8 202/209  
:HMM:PFM   18->72 PF00126 * HTH_1 4.1e-17 34.5 55/60  
:BLT:SWISS 28->302 NAHR_PSEPU 5e-25 29.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68439.1 GT:GENE BAC68439.1 GT:PRODUCT putative LysR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(881547..882500) GB:FROM 881547 GB:TO 882500 GB:DIRECTION - GB:PRODUCT putative LysR-family transcriptional regulator GB:NOTE PF03466: LysR substrate binding domain GB:PROTEIN_ID BAC68439.1 LENGTH 317 SQ:AASEQ MMLVNSPEPVIDANLAIALDALLAEHSVTRAAARLHTSPAAMSRTLARLRRILQDPLLVRAGQAMVPTPRAQSLRDEAAAVVRSLGALLSPGTGVDPADLRSTFTLQAADLVGAALAPGLLHLAQQEAPGVSFRLRAEELEAGTALRDGRIDLEIGSIDHVDPETQVEELVSLRMMAAVRPGHPLTEGPLTPARLAAAEHVAVSRRGRFSGPLDTALAEQNLHRRVSFVLPSHLAAMTLATRSDVVCLVPAAPPGAAPSPLTDDAIALGLFLLDIPLELPPLTIGMAWHPRHTADGAHHWLRNAIRRTLRTPGSPTT GT:EXON 1|1-317:0| BL:SWS:NREP 1 BL:SWS:REP 28->302|NAHR_PSEPU|5e-25|29.6|267/300| SEG 11->24|idanlaialdalla| SEG 106->126|lqaadlvgaalapgllhlaqq| SEG 250->260|paappgaapsp| BL:PDB:NREP 1 BL:PDB:REP 27->244|2esnC|3e-15|29.5|217/298| RP:PDB:NREP 1 RP:PDB:REP 25->241|1b9nB|1e-08|9.5|210/245| HM:PFM:NREP 2 HM:PFM:REP 99->309|PF03466|1e-24|24.8|202/209|LysR_substrate| HM:PFM:REP 18->72|PF00126|4.1e-17|34.5|55/60|HTH_1| RP:SCP:NREP 2 RP:SCP:REP 25->86|2esnA1|1e-10|43.5|62/89|a.4.5.37| RP:SCP:REP 127->310|1utbA|1e-17|21.5|177/214|c.94.1.1| HM:SCP:REP 6->94|2esnA1|2.6e-14|31.5|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 96->309|2esnA2|1.4e-34|32.9|207/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 960 OP:NHOMOORG 281 OP:PATTERN -------------------------------------------------------------------- ----3---------1----------2----------11---1-11----1---2--------1-1-222-----------------------------------------------------------------------------3--------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------31541----111-----------1---21-2-2121-1221458446492-1111--1-11-132222222212311--1-------------------------------13-125324EBDHEF96666AA79777729LB85978--66941221555183131----4-----------161-------1--1------------------9-----------------------------55144-226322334326522224274262--------------4111212112221222-121221122212222222165713--1----------------611111121-21111111111111-2-------1--2518111--1---------22212131124-A9A978676A7A73224----------4665444444486621--------------2-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 89.3 SQ:SECSTR ########################HccHHHHHHHHTccHHHHHHHHHHHHHHHTcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHTTTHHHHHTTccccccEEEEEEEcccEEEEEETTcccEEEEccHHHHHHHTccTTcEEEEEEcGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEEcTTccEEEEEEEGGGcTTccTTcEEEEEEcGGGcEEEcHTccEEEEEGGHHHTT###GccTTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcTTcc####### DISOP:02AL 1-9, 313-317| PSIPRED ccccccccccccHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHcccEEEEEEcccccccccEEEEEEcccEEEEEccccccccccccHHHHHccccEEEEcccccHHHHHHHHHHccccccEEEEEccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccc //