[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68442.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->52 PF07628 * DUF1589 0.00088 29.2 48/164  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68442.1 GT:GENE BAC68442.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 884059..884292 GB:FROM 884059 GB:TO 884292 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68442.1 LENGTH 77 SQ:AASEQ MRRRTLASRISSEMAVSVGRLDNQYSVGASAPSGHSISSRQSGRIPSHQPCSADAVALIGRSTALPAVRTYGGEAGT GT:EXON 1|1-77:0| HM:PFM:NREP 1 HM:PFM:REP 5->52|PF07628|0.00088|29.2|48/164|DUF1589| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 30-48, 73-77| PSIPRED cccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHcccccccHHHHccccccc //