[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68443.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:210 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->205 3b59A PDBj 1e-04 16.1 %
:RPS:SCOP  12->99 1xy7A  d.32.1.9 * 1e-04 20.5 %
:HMM:SCOP  1->103 1f1uA2 d.32.1.3 * 7.7e-11 24.8 %
:HMM:PFM   4->32 PF00903 * Glyoxalase 0.00063 27.6 29/128  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68443.1 GT:GENE BAC68443.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(884559..885191) GB:FROM 884559 GB:TO 885191 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68443.1 LENGTH 210 SQ:AASEQ MNSIASVTLEVADTTAAARFYSTAFGLDSSHVRLRASEAPTTGFRGFTLSLVVSQPGNVDALVGAALDAGATALKPASKSLWGYGGTVQAPDGTIWKIATSTKKDTGPVTRDFDELVLLLGVEDVKASKQFYVEQGLTVGKSFGGKYVEFATGSGPVKLALYKRRALAKDAGVPADGTGSHRLVLSSAAGPFSDPDGFVWEATAPLAATA GT:EXON 1|1-210:0| SEG 59->71|vdalvgaaldaga| SEG 114->125|delvlllgvedv| RP:PDB:NREP 1 RP:PDB:REP 1->205|3b59A|1e-04|16.1|205/294| HM:PFM:NREP 1 HM:PFM:REP 4->32|PF00903|0.00063|27.6|29/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 12->99|1xy7A|1e-04|20.5|88/120|d.32.1.9| HM:SCP:REP 1->103|1f1uA2|7.7e-11|24.8|101/0|d.32.1.3|1/2|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------11----------------------1-----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 97.6 SQ:SECSTR EEEEEEEEEEEccHHHHHHHHHHTTccccccccEEEEEccccEEEEEEEEccHHHHHHHHHHHHHHTcccccccEEcccTTccEEEEEEcTTccEEEEcccccccccTTcccccEEEEEEEEETTHHHHHHHHHTcccEEEEEETTTEEEEcccccccEEEEEcccEEEEEEEEccHHHHHHHHHHHTTccEEcTTccEEEEEEc##### DISOP:02AL 1-2, 36-38, 40-41| PSIPRED cccEEEEEEcHHcHHHHHHHHHHHHccccccEEEEEccccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEccccccccccccEEEcccccEEEEEEccccccccccccHHHEEEEcccccHHHHHHHHHHHccEEcccccccEEEEEccccEEEEEEEEcHHHHHHccccccccccEEEEEEcccccccccccEEEEEcccccccc //