[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68446.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  268/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:68 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->53 1iz1B PDBj 7e-04 31.4 %
:RPS:PDB   1->68 1b9nA PDBj 7e-11 13.2 %
:RPS:SCOP  4->50 1ixcA1  a.4.5.37 * 4e-10 42.6 %
:HMM:SCOP  3->58 1ixcA1 a.4.5.37 * 2.9e-13 51.8 %
:RPS:PFM   5->53 PF00126 * HTH_1 2e-05 53.1 %
:HMM:PFM   5->55 PF00126 * HTH_1 1.4e-20 51.0 51/60  
:BLT:SWISS 1->58 YNFL_ECOLI 2e-14 56.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68446.1 GT:GENE BAC68446.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 887475..887681 GB:FROM 887475 GB:TO 887681 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:NOTE PF00126: Bacterial regulatory helix-turn-helix protein, lysR family GB:PROTEIN_ID BAC68446.1 LENGTH 68 SQ:AASEQ MDVDLRKLRYCLVVAEELHFGRAAERLHITQPVPSRQIRALEQELHARLFTRNKQTTVRASIRLWLRR GT:EXON 1|1-68:0| BL:SWS:NREP 1 BL:SWS:REP 1->58|YNFL_ECOLI|2e-14|56.9|58/297| BL:PDB:NREP 1 BL:PDB:REP 3->53|1iz1B|7e-04|31.4|51/294| RP:PDB:NREP 1 RP:PDB:REP 1->68|1b9nA|7e-11|13.2|68/258| RP:PFM:NREP 1 RP:PFM:REP 5->53|PF00126|2e-05|53.1|49/60|HTH_1| HM:PFM:NREP 1 HM:PFM:REP 5->55|PF00126|1.4e-20|51.0|51/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 1 RP:SCP:REP 4->50|1ixcA1|4e-10|42.6|47/84|a.4.5.37| HM:SCP:REP 3->58|1ixcA1|2.9e-13|51.8|56/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 548 OP:NHOMOORG 270 OP:PATTERN -------------------------------------------------------------------- -1--4--1------1------3---6------22223334-3-2-----1------------2-325351------------4------------------1--------------------------------------------1--1----------------22-2----------------1----1-1222222221222231--1121223-------------1--------------------------------11---------------------------------------------------------------------------------------1-----------------------11---------1--------1----------1------21-2-1--------381--23----1-1-11---1111111111--1-1--------------------------------13-1-43264779743444466434444458252745--43522242413-2222-----11--------1-111---------13111------1---11-122---------------------------22--2--1-------------1----------------1------31-1-112112222211-112221212212211211111----21111-1111111111-111111111--1112221-2111----11111--------1---------------11--1-----5-33242554-21111111------------------------11-1111---1------------------------------------------------------------2- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 100.0 SQ:SECSTR EEEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccEEEcccEEEcHHHHHHHHH PSIPRED ccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHccc //