[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68449.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:HMM:PFM   4->42 PF00324 * AA_permease 0.00027 23.1 39/479  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68449.1 GT:GENE BAC68449.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 888992..889162 GB:FROM 888992 GB:TO 889162 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAC68449.1 LENGTH 56 SQ:AASEQ MVPVLLVLLLALILFGAGFALKALWWIAVIVLVVWVLGFVIRPAGSGGKRGRWYRW GT:EXON 1|1-56:0| TM:NTM 1 TM:REGION 13->35| SEG 4->37|vllvlllalilfgagfalkalwwiavivlvvwvl| HM:PFM:NREP 1 HM:PFM:REP 4->42|PF00324|0.00027|23.1|39/479|AA_permease| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc //