[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68450.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->97 3bl4B PDBj 3e-13 10.3 %
:RPS:SCOP  18->81 2f1lA1  b.41.1.4 * 5e-08 25.0 %
:HMM:SCOP  14->117 1eysH1 b.41.1.1 * 1.5e-18 45.0 %
:HMM:PFM   18->85 PF05239 * PRC 2.9e-06 36.4 66/79  
:HMM:PFM   5->18 PF01310 * Adeno_PVIII 0.00025 57.1 14/217  
:BLT:SWISS 46->96 Y1314_DEIRA 1e-05 43.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68450.1 GT:GENE BAC68450.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 889498..889851 GB:FROM 889498 GB:TO 889851 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF05239: PRC-barrel domain GB:PROTEIN_ID BAC68450.1 LENGTH 117 SQ:AASEQ MSDSIWGYQPTTGHTAGTDLIGYKVEATDGSIGKVDKHSDDVNSSYLVVDTGVWIFGKHVLLPAGTVKTVDQAERKIYVDLTKEQIKDSPEFDKDKHAGDAGYHEQVGSYYQSHRRV GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 46->96|Y1314_DEIRA|1e-05|43.8|48/100| RP:PDB:NREP 1 RP:PDB:REP 18->97|3bl4B|3e-13|10.3|78/109| HM:PFM:NREP 2 HM:PFM:REP 18->85|PF05239|2.9e-06|36.4|66/79|PRC| HM:PFM:REP 5->18|PF01310|0.00025|57.1|14/217|Adeno_PVIII| RP:SCP:NREP 1 RP:SCP:REP 18->81|2f1lA1|5e-08|25.0|64/75|b.41.1.4| HM:SCP:REP 14->117|1eysH1|1.5e-18|45.0|100/201|b.41.1.1|1/1|PRC-barrel domain| OP:NHOMO 26 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------11--2--4-2------------------------------------------------------------------------------12-----------------123------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------1---------------------------------------------1------------------1-----------------------------------------------------------------------------------------------------------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 68.4 SQ:SECSTR #################EccccccccHHHHHHHHHHHHHTTcccEcccHHHHcGHHHHHHHHcccccccEEEEcccGGGHHHHHHHHHHTTccccEE#################### DISOP:02AL 1-3, 113-117| PSIPRED cccccccEEccccccccccEEEEEEEEccccccEEEcccccccEEEEEEEccccccccEEEEEEHHEEEEcccccEEEEcccHHHHHcccccccccccccHHHHHHHHHHccccccc //