[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68461.1
DDBJ      :             hypothetical protein
Swiss-Prot:CAAL1_STRAW  RecName: Full=Carboxylate-amine ligase SAV_751;         EC=6.3.-.-;

Homologs  Archaea  8/68 : Bacteria  218/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.128.1
:362 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->263 1tt4A PDBj 8e-14 24.6 %
:RPS:PDB   1->355 2d32B PDBj 4e-26 12.6 %
:RPS:SCOP  3->359 1r8gA  d.128.1.3 * 1e-24 19.4 %
:HMM:SCOP  1->361 1tt4A_ d.128.1.3 * 5.3e-91 32.4 %
:RPS:PFM   3->234 PF04107 * GCS2 3e-21 36.0 %
:HMM:PFM   2->283 PF04107 * GCS2 3.2e-73 33.8 278/290  
:BLT:SWISS 1->362 CAAL1_STRAW e-179 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68461.1 GT:GENE BAC68461.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 901504..902592 GB:FROM 901504 GB:TO 902592 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF04107: Glutamate-cysteine ligase family 2(GCS2) GB:PROTEIN_ID BAC68461.1 LENGTH 362 SQ:AASEQ MRTVGVEEELLLVDPETGEPKALSTAVLARAEQVDPDQDVFEKELHGQMLEFATHPQTDMAALGAEIVRCRKEAARHAGEAGCAVAALATSPLPVSPSIAMNRRYQWMAEQYGIAMQEQLTCGCHVHVAVESDEEGVAVVDRIRPWLPVLVALSANSPFWQGRDSSYESYRSRVWGRWPSAGPTELFGSPERYHRQVADMVATGVILDDGMVYFDARLSHRYPTVEIRVADVCLHPDTAQLIATLARGLVESAARDWRAGREPEDHSVSLLRLAAWQAARAGLSGELLHPVTMRRLRAESVVRALLEHVGDALADAGDLDLAHEAVAELLERGNGARVQRELLERTGSLRDTVTECVRQTQG GT:EXON 1|1-362:0| SW:ID CAAL1_STRAW SW:DE RecName: Full=Carboxylate-amine ligase SAV_751; EC=6.3.-.-; SW:GN OrderedLocusNames=SAV_751; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->362|CAAL1_STRAW|e-179|100.0|362/362| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 74->89|aarhageagcavaala| SEG 269->285|sllrlaawqaaraglsg| SEG 310->322|gdaladagdldla| BL:PDB:NREP 1 BL:PDB:REP 3->263|1tt4A|8e-14|24.6|244/354| RP:PDB:NREP 1 RP:PDB:REP 1->355|2d32B|4e-26|12.6|348/499| RP:PFM:NREP 1 RP:PFM:REP 3->234|PF04107|3e-21|36.0|222/285|GCS2| HM:PFM:NREP 1 HM:PFM:REP 2->283|PF04107|3.2e-73|33.8|278/290|GCS2| GO:PFM:NREP 2 GO:PFM GO:0004357|"GO:glutamate-cysteine ligase activity"|PF04107|IPR006336| GO:PFM GO:0006750|"GO:glutathione biosynthetic process"|PF04107|IPR006336| RP:SCP:NREP 1 RP:SCP:REP 3->359|1r8gA|1e-24|19.4|340/352|d.128.1.3| HM:SCP:REP 1->361|1tt4A_|5.3e-91|32.4|358/366|d.128.1.3|1/1|Glutamine synthetase/guanido kinase| OP:NHOMO 281 OP:NHOMOORG 227 OP:PATTERN ------------------------11111111------------------------------------ --1-311211111121211-12--2311111221222343-32222--1111332211--113-3-22111-----------3--1-------------1-----1-1-1--------------------------11111---1---------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------111--------------------22222-22----------------11---111------1---------------1-----------------------------------111111111111111111121111111111111--11111111111-1111-----11---------1-111----------------------------1------------------------------------------------------------------------21---1-1111111111-1121111111111111111111-----1111111111111111-1111111-----------------------2212--------------------------------111111--1111------------------------------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 354 STR:RPRED 97.8 SQ:SECSTR TcEEEEEEEEEEEcTTcccccccccGGGccTTTGccTcccEEEcccTTEEEEEccccccHHHHHHHHHHHHHHHHTccTTcEEcccccccccccccHHHHHHHHHHHHHHHHccGGGGGGccEEEEEEEccHHHHHHHHHHHHHHHTTHHHHHHccccEEcGGGccccccccGGGcTTcccccGGGccccccHHHHHHHHccccccccGGGccccEEEEHcccEEEEEEEEccTTcTTcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHTTcTTcEEccTTccccEEHHHHHHHHHHHHHHHHHHHHHHHcc#cHHHHHHHHHHHHHHcGGGcHHHHHHHHHHHH####### PSIPRED ccccHHHHHHHHccccccccccccHHHHHHHHccccccccEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccEEEEcccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccEEEEccccccEEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHcc //