[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68462.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->121 2zhpA PDBj 3e-07 33.9 %
:RPS:PDB   8->123 3ecjB PDBj 2e-13 21.8 %
:RPS:SCOP  7->120 2i7rA1  d.32.1.2 * 4e-14 27.4 %
:HMM:SCOP  1->124 1qipA_ d.32.1.1 * 1.1e-18 32.8 %
:HMM:PFM   8->120 PF00903 * Glyoxalase 9.5e-10 19.8 111/128  
:BLT:SWISS 2->121 BLE_STRHI 1e-06 33.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68462.1 GT:GENE BAC68462.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(903011..903400) GB:FROM 903011 GB:TO 903400 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68462.1 LENGTH 129 SQ:AASEQ MQITASTVSLTVADVAASQAFLTAHLGYTVQAAADGFASLTRADAVDIVLLARGTQVLPPEQRDRHAAGLILAFTLADGLHDQEKRLREAGVEITMPLREEPWGERLFQITDPNGVIIQFVEWATSDDT GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 2->121|BLE_STRHI|1e-06|33.9|109/124| BL:PDB:NREP 1 BL:PDB:REP 2->121|2zhpA|3e-07|33.9|109/120| RP:PDB:NREP 1 RP:PDB:REP 8->123|3ecjB|2e-13|21.8|110/359| HM:PFM:NREP 1 HM:PFM:REP 8->120|PF00903|9.5e-10|19.8|111/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 7->120|2i7rA1|4e-14|27.4|106/115|d.32.1.2| HM:SCP:REP 1->124|1qipA_|1.1e-18|32.8|122/0|d.32.1.1|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN ----------------------------------------------1--------------------- ---------------------------------1111111-1-11----------------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-1-----------------------1-------------------------------------------------------------------------------------------------------------1-1-------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 98.4 SQ:SECSTR cccccccEEEEEccHHHHHHHHTTTTccEEEEEcccEEEEEcTTccccccEcccccEEEEccccEEEEEEEEEccTHHHHHHHHHHHHHTTccEEEETTcccTTccEEEEEcTTccEEEEEcccTTc## DISOP:02AL 54-65, 127-129| PSIPRED cEEEEEEEEEEEccHHHHHHHHHHHcccEEEEccccEEEEEccccEEEEEEEcccccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEccccEEEEEEEEcccccc //