[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68467.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   161->290 1zatA PDBj 2e-08 31.4 %
:RPS:SCOP  162->290 1zatA1  b.160.1.1 * 3e-19 27.5 %
:HMM:SCOP  159->291 1zatA1 b.160.1.1 * 3.1e-26 27.8 %
:RPS:PFM   167->288 PF03734 * YkuD 2e-04 34.5 %
:HMM:PFM   164->290 PF03734 * YkuD 2.1e-18 33.3 108/116  
:BLT:SWISS 69->318 Y493_MYCBO 2e-34 34.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68467.1 GT:GENE BAC68467.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 909086..910072 GB:FROM 909086 GB:TO 910072 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF03734: ErfK/YbiS/YcfS/YnhG GB:PROTEIN_ID BAC68467.1 LENGTH 328 SQ:AASEQ MGRRKGGIGIALVTSVMLVGASACGGGSGDKANGDDAKASGKPGASASPSPKKPAGPPMLLETITPQTGTTVGVAMPISVVFTNPVAAKARAAVEKHMKVSASQPVSGAWHWFGDKRADWRPKTYWPSGTKVKIDADMKGVNNGNGRYGVHSYTHTFKIGDDVRADVSVTGHTMKVTRNGKVVRTLSINAGSAQYPTWNGTMAVIDKQEKVHMTSCSVGISCEKGSPNYYDLTLPWDVHLTQSGTYVHYSTGDPTPGSGSARGSHGCVHLSMSDAKWFYGQVKQGDPVTITGSPRAKAPADNGYADFNLGWDQWLAGSASGEKTTATL GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 69->318|Y493_MYCBO|2e-34|34.6|234/451| SEG 37->58|akasgkpgasaspspkkpagpp| BL:PDB:NREP 1 BL:PDB:REP 161->290|1zatA|2e-08|31.4|121/248| RP:PFM:NREP 1 RP:PFM:REP 167->288|PF03734|2e-04|34.5|116/136|YkuD| HM:PFM:NREP 1 HM:PFM:REP 164->290|PF03734|2.1e-18|33.3|108/116|YkuD| RP:SCP:NREP 1 RP:SCP:REP 162->290|1zatA1|3e-19|27.5|120/126|b.160.1.1| HM:SCP:REP 159->291|1zatA1|3.1e-26|27.8|126/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 214 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- ----511111111156655-5E44565555549699448711111-------1121-1--32112239551-----------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 36.9 SQ:SECSTR ################################################################################################################################################################cccEEEEETTTTEEEEEETTEEEEEEEcccccTTcccccEEEEccccEEEEEccccc#ccccc##cEEEEEEEccc######cccEEEEcTTcccccTTHHHcccccEEEcHHHHHHHHHHccTTcEEEE###################################### DISOP:02AL 1-7, 322-328| PSIPRED ccccccccHHHHHHHHHHccEEEccccccccccccccEEEcccccEEEEcccccccccccccEEEcccccEEEccEEEEEEEccccccHHHHcEEEEEEEEcccccEEEEEEccccEEEEEEccccccccEEEEEEccccccccccccccccccccEEEccEEEEEEEccccEEEEEEccEEEEEEEEEEcccccccccEEEEEEEccccEEEccEEEcccccccccccccccccEEEEEEcccEEEEccccccccccccccccccEEEccHHHHHHHHHHcccccEEEEEcccccccccccccccccccHHHHEEcccccccEEccc //