[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68471.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   45->73 PF06876 * SCRL 0.00053 15.4 26/67  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68471.1 GT:GENE BAC68471.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(912621..912968) GB:FROM 912621 GB:TO 912968 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68471.1 LENGTH 115 SQ:AASEQ MRQGSWRFHRDLGPSPVWGYWATNPHHPHKPIGMGYLGPTFSVTRDHCGTSYTSTAVTQHHSPTACRCRRSARTASMPRTTPPWNRAGPNPTKRSTATPTTTVRACSGITITPWG GT:EXON 1|1-115:0| SEG 64->76|tacrcrrsartas| SEG 92->102|tkrstatpttt| HM:PFM:NREP 1 HM:PFM:REP 45->73|PF06876|0.00053|15.4|26/67|SCRL| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 85-88, 90-91| PSIPRED cccccccccccccccccEEccccccccccccccccccccccEEccccccccccccEEEcccccHHHHHHHHHcccccccccccccccccccccccccccccEEEEccccEEEccc //