[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68473.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68473.1 GT:GENE BAC68473.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(914353..914658) GB:FROM 914353 GB:TO 914658 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68473.1 LENGTH 101 SQ:AASEQ MFALGPREELKEHGADVTTLMPGATDSAFHARAGMNNTAFGSGMKKNSRKDVARQGFLALMDGRAEVVGGDAATKRTALKHRFLPETWKATQHARKAEPQP GT:EXON 1|1-101:0| OP:NHOMO 27 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ---------------1---------1-------1111-------1----------1-----------11--------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1-1-1-------221-2------------1-1-----------------------------------------------------------------------------------1----------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 97-101| PSIPRED cHHHHHHHHHHccccEEEEEEccccccHHHHHccccccccccccccccHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHccHHHHHHHHHHHHcccc //