[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68474.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:265 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->257 1pv7A_ f.38.1.2 * 7.1e-08 26.4 %
:HMM:PFM   11->255 PF07690 * MFS_1 1.1e-06 23.0 243/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68474.1 GT:GENE BAC68474.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(914734..915531) GB:FROM 914734 GB:TO 915531 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68474.1 LENGTH 265 SQ:AASEQ MLGATFLLSGADRLPPRAILSGLALAFAAGTAVLALPGLPVRAVFAVVLLQGLVASLGGGVRGGLLNEILPKDGYVLGRSVFNMLWGLVQMAGFATGGALLALLSPRTCLLLAAALYVMSALVTRLGLTARPPRFLGRPSLSATWRANALLWSSRPRRLTYLGLWVPNGLVVGSDSLYVSYAPQAAGTLYACGALGMFVGDMAVGRLVPPAVRSRLATPLRLLLAAPYLFFVLRPGVAMSAVAATVASVGFAASLVLQERLMAAS GT:EXON 1|1-265:0| TM:NTM 7 TM:REGION 3->25| TM:REGION 35->57| TM:REGION 81->103| TM:REGION 107->129| TM:REGION 188->210| TM:REGION 217->239| TM:REGION 244->265| SEG 18->36|ailsglalafaagtavlal| SEG 92->104|agfatggallall| SEG 215->229|rlatplrlllaapyl| SEG 237->254|vamsavaatvasvgfaas| HM:PFM:NREP 1 HM:PFM:REP 11->255|PF07690|1.1e-06|23.0|243/353|MFS_1| HM:SCP:REP 1->257|1pv7A_|7.1e-08|26.4|254/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------------------------------11-----211----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 264-265| PSIPRED cccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHHEEEEEcHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccEEEEccHHHHHHHHHHHccccEEccccEEEcccHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHHHHEEHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //