[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68475.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->63 PF00420 * Oxidored_q2 0.00023 28.9 38/95  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68475.1 GT:GENE BAC68475.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(915541..915750) GB:FROM 915541 GB:TO 915750 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68475.1 LENGTH 69 SQ:AASEQ MSKQGPWAAPRLRRMRSYRTLFRAPEFAPFLLSFAAFAAAQTVGGLALATLVFRATGSPLLSAVSMFGP GT:EXON 1|1-69:0| SEG 24->40|apefapfllsfaafaaa| HM:PFM:NREP 1 HM:PFM:REP 26->63|PF00420|0.00023|28.9|38/95|Oxidored_q2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccc //