[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68476.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68476.1 GT:GENE BAC68476.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 915952..916188 GB:FROM 915952 GB:TO 916188 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68476.1 LENGTH 78 SQ:AASEQ MLPEERDHRLHGRGERRLLAEEGGADADRDVRESCRRGAQDAAWVAVSAPPVAMTRKAMVIAAAVTSTAISAGTGSGT GT:EXON 1|1-78:0| SEG 4->25|eerdhrlhgrgerrllaeegga| SEG 42->53|aawvavsappva| SEG 60->77|viaaavtstaisagtgsg| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-10, 75-78| PSIPRED ccccccccccccccccEEEcccccccccHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccc //