[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68478.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->127 3e0dA PDBj 9e-09 31.9 %
:RPS:PFM   9->62 PF02811 * PHP 3e-04 42.3 %
:HMM:PFM   4->85 PF02811 * PHP 6.5e-08 36.8 57/175  
:BLT:SWISS 9->64 DNAE2_COREF 5e-06 46.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68478.1 GT:GENE BAC68478.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 918676..919065 GB:FROM 918676 GB:TO 919065 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68478.1 LENGTH 129 SQ:AASEQ MAGYCARYGASLPGALVQRAAERGMTTLAPTGRDTVAGTVRFLFLTAAAAAGSRPVLGVDVARRPSRPAGPVCRTAAYARTRRRARDGAAPADHFARTELARTERGRVDLAVPLVSAAHAEADGALPVS GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 9->64|DNAE2_COREF|5e-06|46.3|54/1073| SEG 74->92|rtaayartrrrardgaapa| RP:PDB:NREP 1 RP:PDB:REP 9->127|3e0dA|9e-09|31.9|94/1148| RP:PFM:NREP 1 RP:PFM:REP 9->62|PF02811|3e-04|42.3|52/177|PHP| HM:PFM:NREP 1 HM:PFM:REP 4->85|PF02811|6.5e-08|36.8|57/175|PHP| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF02811|IPR004013| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------211----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 72.9 SQ:SECSTR ########ccccHHHHHHHHHHHcccEEEEEEETccTTHHH##HHHHHHTTTcEEEEEEEEccTTcccccc######################EEEEEEEEccHHHHHHH#HHHHHHHHHTcccccc## DISOP:02AL 129-130| PSIPRED ccccccccccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHcccccEEEEEEEEccccccccHHHHHHHHcccccHHccccccHHHHHHHHHHHcccEEEEEEEEcHHHHHccccccccc //