[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68479.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->119 3ecjB PDBj 2e-06 13.5 %
:RPS:SCOP  1->119 1mpyA1  d.32.1.3 * 2e-06 17.4 %
:HMM:SCOP  1->120 1q0oA2 d.32.1.3 * 7.6e-14 27.3 %
:HMM:PFM   5->118 PF00903 * Glyoxalase 1.5e-07 21.9 114/128  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68479.1 GT:GENE BAC68479.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(919505..919888) GB:FROM 919505 GB:TO 919888 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68479.1 LENGTH 127 SQ:AASEQ MACRISELVIDVADPERLAAFWSKVLGYVELGREDDGSIQIGPPDAGFGGPQPTLVLSASSDPRPGKLPLHIDVNATDRDQDAELERLLALGARPADVGQTGAESWHVLADPEGNEFCLLRTRLQPL GT:EXON 1|1-127:0| SEG 83->96|aelerllalgarpa| RP:PDB:NREP 1 RP:PDB:REP 4->119|3ecjB|2e-06|13.5|111/359| HM:PFM:NREP 1 HM:PFM:REP 5->118|PF00903|1.5e-07|21.9|114/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->119|1mpyA1|2e-06|17.4|115/145|d.32.1.3| HM:SCP:REP 1->120|1q0oA2|7.6e-14|27.3|110/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 35 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- --------------2------1----------21111113--1-12---11-12------12--11-232----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 93.7 SQ:SECSTR TTTEEEEEEEEEccHHHHHHHHTTTTccEEEEEcccEEEEEEETEcTTccccccEEEEEccccEEEEEEEEccTHHHHHHHHHHHHTTccEEEETTcccTTTcccEEEEEcTTccEEEE######## DISOP:02AL 126-127| PSIPRED ccEEEEEEEEEcccHHHHHHHHHHHcccEEccccccccccccccccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHHHcccEEEEccccccccEEEEEcccccEEEEEccccccc //